Loading...
Statistics
Advertisement

Vyrs.com

Advertisement
Conversion Technology Metas Server
Vyrs.com is hosted in United States / New York . Vyrs.com doesn't use HTTPS protocol. Number of used technologies: 2. First technologies: Html, Javascript, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: DOSarrest.

Technologies in use by Vyrs.com

Technology

Number of occurences: 2
  • Html
  • Javascript

Advertisement

Server Type

  • DOSarrest

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Vyrs.com

Missing HTTPS protocol.

    Meta - Vyrs.com

    Number of occurences: 1
    • Name:
      Content: text/javascript

    Server / Hosting

    • IP: 69.172.201.153
    • Latitude: 40.69
    • Longitude: -74.02
    • Country: United States
    • City: New York

    Rname

    • ns1.uniregistrymarket.link
    • ns2.uniregistrymarket.link

    Target

    • hostmaster.hostingnet.com

    HTTP Header Response

    HTTP/1.1 200 OK Date: Thu, 13 Oct 2016 00:19:20 GMT Content-Type: text/html Server: DOSarrest P3P: CP="NON DSP COR ADMa OUR IND UNI COM NAV INT" Cache-Control: no-cache X-Cache: MISS from s_wx1189 Transfer-Encoding: chunked Via: 1.1 s_wx1189 (squid/3.5.20) Connection: keep-alive

    DNS

    host: vyrs.com
    1. class: IN
    2. ttl: 300
    3. type: A
    4. ip: 69.172.201.153
    host: vyrs.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns1.uniregistrymarket.link
    host: vyrs.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns2.uniregistrymarket.link
    host: vyrs.com
    1. class: IN
    2. ttl: 86400
    3. type: SOA
    4. mname: ns1.uniregistrymarket.link
    5. rname: hostmaster.hostingnet.com
    6. serial: 1475855997
    7. refresh: 10800
    8. retry: 3600
    9. expire: 604800
    10. minimum-ttl: 86400

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.yrs.com, www.vyyrs.com, www.yyrs.com, www.vzyrs.com, www.zyrs.com, www.vhyrs.com, www.hyrs.com, www.vnyrs.com, www.nyrs.com, www.vmyrs.com, www.myrs.com, www.vjyrs.com, www.jyrs.com, www.vkyrs.com, www.kyrs.com, www.viyrs.com, www.iyrs.com, www.vrs.com, www.vyzrs.com, www.vzrs.com, www.vyars.com, www.vars.com, www.vysrs.com, www.vsrs.com, www.vydrs.com, www.vdrs.com, www.vyrs.com, www.vrs.com, www.vycrs.com, www.vcrs.com, www.vy rs.com, www.v rs.com, www.vys.com, www.vyris.com, www.vyis.com, www.vyros.com, www.vyos.com, www.vyrls.com, www.vyls.com, www.vyrls.com, www.vyls.com, www.vyr.s.com, www.vy.s.com, www.vyr.com, www.vyrse.com, www.vyre.com, www.vyrsw.com, www.vyrw.com, www.vyrsd.com, www.vyrd.com, www.vyrsx.com, www.vyrx.com, www.vyrsf.com, www.vyrf.com, www.vyrsg.com, www.vyrg.com, www.vyrst.com, www.vyrt.com,

    Other websites we recently analyzed

    1. bellcellphones.com
      Road Town (Virgin Islands, British) - 208.91.196.52
      Server software: Microsoft-IIS/8.5
      Technology: Html
      Number of meta tags: 2
    2. jyvaskylanhammaslaakariasema.fi
      Finland - 217.149.52.104
      Server software: Apache/2.4.10 (Unix) OpenSSL/0.9.8e-fips-rhel5 mod_bwlimited/1.4
      Technology: Html
      Number of meta tags: 1
    3. blacksheephdfc.com
      Los Angeles (United States) - 74.124.205.131
      Server software: Apache/2
      Technology: Html
    4. Ben Ravilious - photographs and images of Leicester Singapore Devon
      Photographs of the city of Leicester. Also images of North Devon and Singapore, leicester photos, leicester photographs, leicester photographer, leicester images, leicester pictures, singapore photos, singapore photographs, singapore photographer, singapore images, singapore pictures, photos of leicester, photographs of leicester, images of leicester, pictures of leicester, leicester town hall
      Dublin (Ireland) - 52.17.153.21
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Javascript
      Number of Javascript: 1
      Number of meta tags: 12
    5. www.monkeytail.org
      San Francisco (United States) - 192.0.78.24
      Server software: nginx
      Technology: CSS, Html, Html5, Javascript, Php, Pingback, Shortcodes, SVG, comScore, Wordpress, Twitter Button
      Number of Javascript: 6
      Number of meta tags: 9
    6. Lopez Taibo - Proximamente
      Overland Park (United States) - 69.64.95.53
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    7. Home
      Scottsdale (United States) - 107.180.44.132
      Server software: Apache/2.4.16
      Technology: CSS, Html, Html5, Javascript, jQuery
      Number of Javascript: 5
      Number of meta tags: 6
    8. scheidung-ausland.de
      Germany - 217.160.223.19
      Server software: Apache
      Technology: Html
      Number of meta tags: 3
    9. lunaandchloeweddings.com
      Road Town (Virgin Islands, British) - 208.91.196.143
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    10. SyvälläPelissä
      Finland - 80.69.161.43
      Server software: Apache
      Technology: Html
      Number of meta tags: 1

    Check Other Websites